PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.8G136700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 754aa    MW: 80270.3 Da    PI: 6.549
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.8G136700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS418.94.3e-1283757521374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.............sseel 78 
                         lv+lLl+cA++vs+gd+  a + L  l+  asp gd+mqR+a+yf+ ALaarl+ s++  +++ ++ +++++              s e+l
  Sevir.8G136700.1.p 375 LVHLLLACADFVSKGDQPSALRHLHLLRRVASPLGDSMQRVASYFADALAARLSLSSNPSSSSSSSGAATPRGgaaagvapytfppSPETL 465
                         68***************************************************99666555555555555444577889999999999999 PP

                GRAS  79 aalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfA 169
                         ++++++++++P++kf+h+taNqaI ea++ge+rvH++D+di qG QWpa+lqaLa+Rp+gpp+lR+Tgvg+     + +++etg+ La++A
  Sevir.8G136700.1.p 466 KIYQILYQACPYIKFAHFTANQAIFEAFAGEDRVHVVDLDILQGYQWPAFLQALAARPGGPPTLRLTGVGH----PAAAVRETGRHLASLA 552
                         999********************************************************************....88************** PP

                GRAS 170 eelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflea 260
                         ++l+vpfef++ +a+rle l++ +L+ + gEalaVn v +lhr++  s++l      +L+++++  Pk++++veqea hn++ Fl rflea
  Sevir.8G136700.1.p 553 ASLRVPFEFHAAAADRLERLRPAALQRRVGEALAVNAVNRLHRVP--SAHLGP----LLSMIRDQAPKIMTLVEQEAGHNGPYFLGRFLEA 637
                         ***********9999*****************************9..666666....********************************** PP

                GRAS 261 leyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyr 350
                         l+yysa+fdsl+a++p++s  r+kvE+ ll++ei+nvvacegaer++rhe+l +Wr+ +e  GF+pvpls  a  q + ll  ++ sdgyr
  Sevir.8G136700.1.p 638 LHYYSAIFDSLDATFPADSAPRMKVEQCLLAPEIRNVVACEGAERVARHERLDRWRRLMEGRGFEPVPLSPAAIGQSQVLLGLYGaSDGYR 728
                         ******************************************************************************************* PP

                GRAS 351 veeesgslvlgWkdrpLvsvSaWr 374
                         + e++g+l+lgW+dr+++++SaW+
  Sevir.8G136700.1.p 729 LTEDKGCLLLGWQDRAIIAASAWQ 752
                         ***********************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.347349731IPR005202Transcription factor GRAS
PfamPF035141.5E-125375752IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 754 aa     Download sequence    Send to blast
MGMLNCADTS SGAKLQQLQA PTSPTASVSE SNIVVSSTDP DANDALAGLQ ALKFDGDIDV  60
EIQSPDIAMW ESLFAEQMGA SGGDFLMSFS PRRDFTATGS PRRDFMVSSP KRDYMMSSPK  120
RDYMVSSPKR DYMMSSPKRE YMVTSPRRDS SPRRSTFSNL YSGTGSHQQG YVDGVHGAEG  180
GSGSGGGQPL YGGLANHGKG KSQSPLHKVY INNAHSNGGR STGPSSLSCS SSYGHGESLS  240
LPSMDPFLDE YKEGGGYLAG YQLPVKTGME NGAASAATVT TVAPSPSQLP TLSECLAMPE  300
PVYGGSEAAA AGGLQMGAGL PAELYYGGQF GGDGFTLQHQ MAKSDQWAGD SSLHSMLGSV  360
IQTEAEQEQD SGLQLVHLLL ACADFVSKGD QPSALRHLHL LRRVASPLGD SMQRVASYFA  420
DALAARLSLS SNPSSSSSSS GAATPRGGAA AGVAPYTFPP SPETLKIYQI LYQACPYIKF  480
AHFTANQAIF EAFAGEDRVH VVDLDILQGY QWPAFLQALA ARPGGPPTLR LTGVGHPAAA  540
VRETGRHLAS LAASLRVPFE FHAAAADRLE RLRPAALQRR VGEALAVNAV NRLHRVPSAH  600
LGPLLSMIRD QAPKIMTLVE QEAGHNGPYF LGRFLEALHY YSAIFDSLDA TFPADSAPRM  660
KVEQCLLAPE IRNVVACEGA ERVARHERLD RWRRLMEGRG FEPVPLSPAA IGQSQVLLGL  720
YGASDGYRLT EDKGCLLLGW QDRAIIAASA WQC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-553757524375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004980521.10.0PREDICTED: DELLA protein GAI-like
TrEMBLK3ZM940.0K3ZM94_SETIT; Uncharacterized protein
STRINGSi027708m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92213141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.12e-95RGA-like 1